SKU: 85464149532

EphA7 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphA7 His Tag Protein, HumanProduct Specification Species Human Antigen EphA7 Synonyms EHK 3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein Accession Q15375 1 Amino Acid Sequence Gln28 Val555, with C terminal 10*His

Product Specification


Species Human
Antigen EphA7
Synonyms EHK-3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein
Accession Q15375-1
Amino Acid Sequence

Gln28-Val555, with C-terminal 10*His QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 68-75kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Xiangyi Chen, Dechen Yu, Haiyu Zhou, Xiaobo Zhang, Yicun Hu, Ruihao Zhang, Xidan Gao, Maoqiang lin, Taowen Guo & Kun Zhang Clinical and Translational Oncology volume 24, pages1274-1289 (2022).

Background

Ephrin-a receptor 7, also known as EphA7, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. At the same time, in recent years, more and more studies have shown that EphA7 protein is abnormally expressed in a variety of malignant tumors, involved in tumor occurrence and metastasis, and correlated with patient prognosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85464149532

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Randy W R
Waukegan, US
★★★★★ 5
Durable and he loves it! It is Ryker Der Hauswolf approved and I recommend it.
Size: X-Large (Pack of 1), Color: Blue Snake, Size: X-Large (Pack of 1), Color: Blue Snake
Review of Outward Hound Durablez Snake – Squeaky Plush Dog Toy, No Stuffing for Less Mess, Interactive & Tough, 6 Jumbo Squeakers, Puppies & Dogs, X-Large, 40" My best friend brought her 16-month-old German Shepherd up for a visit and I happen to love him to pieces! A few months ago, I bought the smaller version of this same toy snake for him and he LOVED it. Many squeaker toys he has eventually torn up, as puppies and others do. The smaller only has a small tear in the butt-end from playing some minor tug of war with it. This larger version is made just as well and with the same materials. It is very durable, but there are no toys indestructible. The only difference is the length, and it has 6 JUMBO squeakers as opposed to 5 smaller ones. It got here on the day of this post and he has not stopped playing with it! Now if you’re one that squeakers get on your nerves, this is not for you. But, if you’re like me and truly enjoy watching (and hearing) a fur baby having so much fun, then buy this now! The price is very reasonable in my humble opinion. It is Ryker Der Hauswolf approved and I recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
P
Verified Purchase
Pocketfrog
Pawtucket, US
★★★★★ 5
Absolutely one of the best chew toys I've ever bought my dog
Size: Large (Pack of 1), Color: Green Gecko
Absolutely one of the best chew toys I've ever bought my dog. She's a lab-pit mix, about 70 lbs, loves to chew, and is almost pure muscle. There are no half-measures with my dog. When she plays tug of war, she's playing to win. Often, she ends up whipping her entire body back and forth violently to get that thing out of your hands. Playing with her feels like you're pulling against a freight truck. I've never had a plush chew toy last longer than 15-20 minutes. It rips, and suddenly out comes all the stuffing and squeakers. Impossible. I just stopped buying her plush toys altogether, which was such a shame because I know that's her favorite thing ever. But when I saw this on Amazon, I thought I'd give it a try. I wasn't expecting much, nothing is truly invincible. BUT THIS THING IS TOUGH! It's my dog's favorite, she loves the squeakers so much, and so we've played tug of war or keep away nearly every day since I bought it. Yeah, there's a small hole in it now, the fur's a little matted and it doesn't look at pretty as when I bought it, BUT IT STILL LIVES! It's lasted three whole months, which is miracle given my dog's seriously aggressive play style. Squeakers are intact, the black lining has held up, I really can't believe it. I've even given her free reign with it over the past couple of weeks, as I have another one saved for the day this finally dies. Even though she's allowed to take this thing behind the couch and really go at it in a serious chew session, she can't break that black lining. Amazing product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2016
M
Verified Purchase
Mason Thompson
Draper, US
★★★★★ 2
Cute? Yes! Durable? Not so much…
Size: Large (Pack of 1), Color: Green Gecko, Size: Large (Pack of 1), Color: Green Gecko
Upon opening this toy I was hopeful that it would last my dog (medium size beagle mix) quite a while. While he enjoyed it, he was able to start ripping it up less than 24 hours after getting it. Now 10 days later, he’s completely destroyed it. He was able to rip open all layers of material, pull them apart, and tear all the squeakers out. While the squeakers are large, they could be a choking hazard for a large dog. Based on the advertised “durability” of this toy and how little time it lasted my dog, I would not purchase it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
T
Verified Purchase
T. Timms
San Leandro, US
★★★★★ 4
German Shepard destroy
Size: Medium (Pack of 1), Color: Orange Gecko, Size: Medium (Pack of 1), Color: Orange Gecko
We've been playing with this lizard for a month now and the fabric has been ripped off within first few days but my dog hasn't got to the squeakers yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
A
Verified Purchase
AmazonBob407
Charlottesville, US
★★★★★ 5
This worm, pretty sure it’s a worm and not a snake, can take a lot of abuse.
Size: X-Large (Pack of 1), Color: Blue Snake, Size: X-Large (Pack of 1), Color: Blue Snake
Snake, worm, whatever, my dog doesn’t care, she loves it all the same. My little friend can be kinda rough with her toys. This is no exception. The pictures are from roughly one month of giving it to her and include playing with it at least every other day or so. The top is holding up well, but the bottom has taken some damage, and two of the squeakers have long since been destroyed. Despite this, my dog still loves playing with it. We normally play tug of war together, but on her own she chews at it to get to the squeakers inside, which she promptly destroys, which I’m totally fine with, as quiet toys are much preferred, by me, not her. I believe there are 4 in the XL size that we got. We’ve had a few of these in the past. We tend to get about 6 months out of them. After she “lovingly” removes the squeakers, she doesn’t chew on it much, and we just use it for tug of war, but at that point she’s done enough damage to the underside that its time is limited. But, as it’s pretty low priced, for the time and enjoyment we do get out of it, it’s very much worth it. I do need to clarify, the durability is actually quite good, I don’t fault the product as at all, it’s just my dog is equally as good with destruction, but it should be noted this toy does last much longer than most of her victims. The color, (we got the blue and green) is also very vivid and nice, as is the texture. We’ll be purchasing again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 23, 2024

recommand products